PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10040638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 176aa    MW: 18798.3 Da    PI: 8.6168
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10040638genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.86e-46171161100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv+apyfpa+qp+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++lal++
  Lus10040638  17 PCAACKLLRRRCAQDCVFAPYFPADQPHKFANVHKVFGASNVNKMLQELPVHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQLALAQ 114
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Lus10040638 115 AE 116
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.50216117IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4517114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MKENNNGRKQ GGAAASPCAA CKLLRRRCAQ DCVFAPYFPA DQPHKFANVH KVFGASNVNK  60
MLQELPVHQR GDAVSSMVYE ANARVRDPVY GCVGAISSLQ QQIDVLQTQL ALAQAEVVHL  120
RVRQTAGFSG HGLSSGSPSH SGSPSSRLMG ISQGKPIFDM DMVDHASLGE SMWSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009353911.11e-105PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-83LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A067KK061e-102A0A067KK06_JATCU; Uncharacterized protein
STRINGPOPTR_0001s11610.12e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.17e-80LOB domain-containing protein 4